Dpysl5 Rabbit Polyclonal Antibody

CAT#: TA337993

Rabbit Polyclonal Anti-Dpysl5 Antibody

Product Images

Host: Rabbit; Target Name: Dpysl5; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dpysl5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dpysl5. Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: dihydropyrimidinase-like 5
• Database Link:
  NP_075534
  Entrez Gene 65254 Mouse
  UniProt ID Q9EQF6
• Background: Dpysl5 may have a function in neuronal differentiation and/or axon growth.
• Synonyms: CRAM; CRMP-5; CRMP5; DRP-5; FLJ45383; OTTHUMP00000200913; Ulip6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%