Antibodies

Jump to Filters
View as table Download
FCN3 Rabbit Polyclonal Antibody
TA346100

USD 475.00

5 Days

Rabbit Polyclonal Anti-FCN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FCN3 antibody: synthetic peptide directed towards the N terminal of human FCN3. Synthetic peptide located within the following region: LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL
FCN3 Rabbit Polyclonal Antibody
TA376191

USD 220.00

3 Weeks

FCN3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 13-288 of human FCN3 (NP_775628.1).
Modifications Unmodified