FCN3 Rabbit Polyclonal Antibody

CAT#: TA346100

Rabbit Polyclonal Anti-FCN3 Antibody

Product Images

WB Suggested Anti-FCN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FCN3 antibody: synthetic peptide directed towards the N terminal of human FCN3. Synthetic peptide located within the following region: LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: ficolin 3
• Database Link:
  NP_003656
  Entrez Gene 8547 Human
  UniProt ID O75636
• Background: Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity.
• Synonyms: FCNH; HAKA1
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Zebrafish: 92%; Pig: 91%; Mouse: 91%; Bovine: 91%; Dog: 79%; Rabbit: 79%; Guinea pig: 77%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein