Antibodies

View as table Download

Rabbit Polyclonal FTO Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FTO antibody was raised against a 15 amino acid synthetic peptide from near the amino terminus of human FTO. The immunogen is located within the first 50 amino acids of FTO.

Goat Anti-FTO (Mouse) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QQKPDCRPYWEKDD, from the Internal region of the protein sequence according to NP_036066.2.

Rabbit Polyclonal Anti-Fto Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fto antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV

Rabbit Polyclonal Anti-FTO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FTO antibody: synthetic peptide directed towards the middle region of human FTO. Synthetic peptide located within the following region: WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Rabbit Polyclonal Anti-FTO Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FTO

FTO rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FTO

FTO Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 416-505 of human FTO (NP_001073901.1).
Modifications Unmodified

FTO Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FTO.

FTO Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human FTO. AA range:19-68