Antibodies

View as table Download

GJC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the middle region of human GJC1. Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI

Rabbit Polyclonal Anti-GJC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1

Rabbit Polyclonal Anti-GJC1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GJC1

GJC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 247-396 of human GJC1 (NP_005488.2).
Modifications Unmodified