Rabbit polyclonal anti-MINPP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MINPP1. |
Rabbit polyclonal anti-MINPP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MINPP1. |
Rabbit polyclonal antibody to MIPP (multiple inositol polyphosphate histidine phosphatase, 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 246 and 487 of MIPP (Uniprot ID#Q9UNW1) |
Rabbit Polyclonal Anti-MINPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MINPP1 antibody is: synthetic peptide directed towards the C-terminal region of Human MINPP1. Synthetic peptide located within the following region: VPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDL |
MINPP1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 298-487 of human MINPP1 (NP_004888.2). |
Modifications | Unmodified |