Rabbit anti-NDRG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NDRG1 |
Rabbit anti-NDRG1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NDRG1 |
Goat Polyclonal Antibody against NDRG1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence GNSAGPKSMEVSC, from the C Terminus of the protein sequence according to NP_006087.2. |
Rabbit Polyclonal Anti-NDRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the C terminal of human NDRG1. Synthetic peptide located within the following region: GSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGA |
Rabbit Polyclonal Anti-NDRG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the N terminal of human NDRG1. Synthetic peptide located within the following region: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG |
Anti-NDRG1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 381-394 amino acids of human N-myc downstream regulated 1 |
Phospho-NDRG1-T346 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around T346 of human NDRG1 (NP_001128714.1). |
Modifications | Phospho T346 |
Phospho-NDRG1-S330 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S330 of human NDRG1 (NP_001128714.1). |
Modifications | Phospho S330 |