Rabbit Polyclonal Anti-P2RX7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | P2RX7 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human P2RX7. |
Rabbit Polyclonal Anti-P2RX7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | P2RX7 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human P2RX7. |
Goat Anti-P2RX7 / P2X7 receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence YETNKVTRIQSMNY-C, from the N-Terminus of the protein sequence according to NP_002553.2. |
Rabbit Polyclonal Anti-PDIA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PDIA1 antibody was raised against a 17 amino acid peptide near the center of human PDIA1. |
P2X7 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gibbon |
Immunogen | P2RX7 / P2X7 antibody was raised against synthetic 16 amino acid peptide from internal region of human P2RX7 / P2X7. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Pig (88%); Mouse, Horse (81%). |
Rabbit Polyclonal Anti-P2RX7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP |
Rabbit Polyclonal Anti-P2RX7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP |
P2RX7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 47-334 of human P2RX7 (NP_002553.3). |
Modifications | Unmodified |