Antibodies

View as table Download

Rabbit Polyclonal Anti-PUS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUS7 antibody: synthetic peptide directed towards the N terminal of human PUS7. Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH

PUS7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 352-661 of human PUS7 (NP_061915.2).
Modifications Unmodified