PUS7 Rabbit Polyclonal Antibody

CAT#: TA339348

Rabbit Polyclonal Anti-PUS7 Antibody

Product Images

WB Suggested Anti-PUS7 Antibody Titration: 1.25 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PUS7 antibody: synthetic peptide directed towards the N terminal of human PUS7. Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: pseudouridylate synthase 7 (putative)
• Database Link:
  NP_061915
  Entrez Gene 54517 Human
  UniProt ID Q96PZ0
• Background: The function remains unknown.
• Synonyms: FLJ20485; KIAA1897; MGC17720
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%; Yeast: 77%; Goat: 75%