Antibodies

View as table Download

Rabbit polyclonal anti-Ras-GRF1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Ras-GRF1.

Rabbit polyclonal Ras-GRF1 (Ser916) antibody(Phospho-specific)

Applications IHC
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Ras-GRF1 around the phosphorylation site of serine 916 (R-M-SP-L-A).
Modifications Phospho-specific

Rabbit polyclonal Anti-RASGRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the middle region of human RASGRF1. Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG

Rabbit polyclonal Anti-RASGRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

RASGRF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human RASGRF1 (NP_001139120.1).
Modifications Unmodified