RASGRF1 Rabbit Polyclonal Antibody

CAT#: TA342190

Rabbit polyclonal Anti-RASGRF1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Other products for "RASGRF1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name Ras protein specific guanine nucleotide releasing factor 1
Background The protein encoded byThis gene is a guanine nucleotide exchange factor (GEF) similar toThe Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated thatThis protein stimulatesThe dissociation of GDP from RAS protein.The studies ofThe similar gene in mouse suggested thatThe Ras-GEF activity ofThis protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated thatThe Ras-GEF signaling pathway mediated byThis protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Mar 2009]
Synonyms CDC25; CDC25L; GNRP; GRF1; GRF55; H-GRF55; PP13187; ras-GRF1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 93%; Mouse: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways Focal adhesion, MAPK signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.