Rabbit Polyclonal Anti-RNH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: RELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNN |
Rabbit Polyclonal Anti-RNH1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNH1 antibody: synthetic peptide directed towards the middle region of human RNH1. Synthetic peptide located within the following region: LLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEG |
Rabbit polyclonal RNH1 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RNH1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 425-454 amino acids from the C-terminal region of human RNH1. |
Rabbit Polyclonal Anti-RNH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ |
Rabbit Polyclonal Anti-RNH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RNH1 |
RNH1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RNH1 |
RNH1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 202-461 of human RNH1 (NP_002930.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
