Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

CAT#: TA330921

Rabbit Polyclonal Anti-RNH1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RNH1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 50 kDa
Gene Name ribonuclease/angiogenin inhibitor 1
Background RNH1 is the inhibitor of pancreatic RNase and angiogenin. RNH1 may also function in the modulation of cellular activities.
Synonyms RAI; RNH
Note Rat: 100%; Human: 100%; Horse: 93%; Mouse: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.