Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIP12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIP12 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human TRIP12.

S1PR2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human S1PR2

Rabbit polyclonal anti-EDG5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EDG5.

Rabbit Polyclonal Anti-S1PR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE

Rabbit Polyclonal Anti-S1PR2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human S1PR2

S1PR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human S1PR2 .