S1PR2 Rabbit Polyclonal Antibody

CAT#: TA338190

Rabbit Polyclonal Anti-S1PR2 Antibody

Product Images

Host: Rabbit; Target Name: S1PR2; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: sphingosine-1-phosphate receptor 2
• Database Link:
  NP_004221
  Entrez Gene 9294 Human
  UniProt ID O95136
• Background: This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. This protein participates in sphingosine 1-phosphate-induced cell proliferation, survival, and transcriptional activation.
• Synonyms: AGR16; EDG-5; EDG5; Gpcr13; H218; LPB2; S1P2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction