Antibodies

View as table Download

Rabbit Polyclonal ZBTB38 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB38 antibody: human ZBTB38 (zinc finger and BTB domain containing 38), using three KLH-conjugated synthetic peptides, two containing a sequence from the central part and one containing a sequence from the C-terminal part of the p

Rabbit polyclonal anti-ZBTB38 antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for anti-ZBTB38 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS