Rabbit Polyclonal DNMT3A Antibody
Applications | WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 10-50 of human Dnmt3a was used as the immunogen. |
Rabbit Polyclonal DNMT3A Antibody
Applications | WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 10-50 of human Dnmt3a was used as the immunogen. |
Rabbit Polyclonal Anti-IL4I1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS |
Rabbit Polyclonal Anti-MAT2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT2A antibody: synthetic peptide directed towards the middle region of human MAT2A. Synthetic peptide located within the following region: LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK |
Rabbit polyclonal Anti-MAT2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the N terminal of human MAT2B. Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA |
Rabbit polyclonal Anti-MAT2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the middle region of human MAT2B. Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE |
Anti-MAT1A Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-MAT1A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-DNMT3L Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like |
Anti-DNMT3L Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like |
Anti-DNMT3A Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Anti-DNMT3A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Anti-APIP Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-APIP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-AMD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-DNMT1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1 |
Anti-AMD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-AMD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-TAT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase |
Rabbit Polyclonal Anti-DNMT3A Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DNMT3A |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBS |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GOT1 |
Rabbit Polyclonal Anti-CDO1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDO1 |
Rabbit Polyclonal Anti-GOT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GOT2 |
Rabbit Polyclonal Anti-TRDMT1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TRDMT1 |
GOT2 Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GOT2 |
AMD1 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
LDHAL6A Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-DNMT3B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DNMT3B |
Rabbit Polyclonal anti-DNMT3B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DNMT3B |