Rabbit Polyclonal Antibody against MOP3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human MOP3 (C-terminus). |
Rabbit Polyclonal Antibody against MOP3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human MOP3 (C-terminus). |
BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around aa.569~573 derived from Human BMAL1 |
Rabbit Polyclonal Antibody against BMAL
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human BMAL1 |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around aa.569~573 derived from Human BMAL1 |
Goat Anti-BMAL1 / ARNTL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1. |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARNTL |