Anti-Human 4-1BB Receptor Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human 4-1BB Receptor |
Anti-Human 4-1BB Receptor Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human 4-1BB Receptor |
Biotinylated Anti-Human 4-1BB Receptor Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human 4-1BB Receptor |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
Applications | WB |
Reactivities | Canine, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFRSF9 |