CSNK1G2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
CSNK1G2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-CSNK1G2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the N terminal of human CSNK1G2. Synthetic peptide located within the following region: FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK |
Rabbit Polyclonal Anti-CSNK1G2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the middle region of human CSNK1G2. Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR |