Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-PACS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PACS2 antibody was raised against a 17 amino acid peptide near the center of human PACS2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DTX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DTX4 Antibody is: synthetic peptide directed towards the C-terminal region of Human DTX4. Synthetic peptide located within the following region: TVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD |
Rabbit Polyclonal Anti-DTX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DTX4 Antibody is: synthetic peptide directed towards the C-terminal region of Human DTX4. Synthetic peptide located within the following region: LPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEV |
Active filters
Target Symbol
- DTX4
Clonalities
- Polyclonal
Pathways
- Notch signaling pathway