Goat Anti-MTHFS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KRCLQHQEVKPYT, from the internal region of the protein sequence according to NP_006432.1. |
Goat Anti-MTHFS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KRCLQHQEVKPYT, from the internal region of the protein sequence according to NP_006432.1. |
Rabbit Polyclonal Anti-MTHFS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS. Synthetic peptide located within the following region: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY |
Rabbit Polyclonal Anti-MTHFS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS. Synthetic peptide located within the following region: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY |