MTHFS Rabbit Polyclonal Antibody

CAT#: TA340111

Rabbit Polyclonal Anti-MTHFS Antibody

Product Images

WB Suggested Anti-MTHFS Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS. Synthetic peptide located within the following region: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)
• Database Link:
  NP_006432
  Entrez Gene 10588 Human
  UniProt ID P49914
• Background: The exact function of MTHFS remains unknown.
• Synonyms: HsT19268
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Dog: 79%; Pig: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Pathways: Metabolic pathways, One carbon pool by folate