Antibodies

Jump to Filters
View as table Download
ACOT12 Rabbit Polyclonal Antibody
TA312609

USD 345.00

4 Weeks

Rabbit polyclonal anti-ACOT12 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACOT12.
ACOT12 Rabbit Polyclonal Antibody
TA340256

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACOT12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOT12 antibody: synthetic peptide directed towards the middle region of human ACOT12. Synthetic peptide located within the following region: SASRLCWAHPFLKSVDMFKFRGPSTVGDRLVFTAIVNNTFQTCVEVGVRV