Antibodies

View as table Download

NCF4 (228-238) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Equine, Human, Monkey
Immunogen Synthetic peptide from an internal region of human NCF4

Anti-NCF4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 190 amino acids of human neutrophil cytosolic factor 4, 40kDa

Goat Polyclonal Antibody against NCF4 / P40PHOX

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KDFPEEDDPTN, from the internal region of the protein sequence according to NP_000622.2; NP_038202.1.

Rabbit Polyclonal Anti-NCF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the N terminal of human NCF4. Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

Rabbit Polyclonal Anti-NCF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the middle region of human NCF4. Synthetic peptide located within the following region: TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF

Phospho-NCF4/p40-phox-T154 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T154 of human NCF4.
Modifications Unmodified