Rabbit Polyclonal anti-NHE3 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide mapping to AA 809 to 831 of rat sequence |
Rabbit Polyclonal anti-NHE3 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide mapping to AA 809 to 831 of rat sequence |
Rabbit Polyclonal Anti-SLC9A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC9A3 Antibody: synthetic peptide directed towards the middle region of human SLC9A3. Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR |
Anti-SLC9A3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 397-411 amino acids of Human solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 |
Anti-SLC9A3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 397-411 amino acids of Human solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 |
SLC9A3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 460-600 of human SLC9A3 (NP_004165.2). |
Modifications | Unmodified |