Antibodies

View as table Download

Rabbit Polyclonal Anti-ACPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Rabbit polyclonal antibody to ACPP (acid phosphatase, prostate)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 177 and 362 of Prostatic Acid Phosphatase

Goat Anti-ACPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-YGIHKQKEKSRLQ, from the internal region of the protein sequence according to NP_001090.2.

Goat Anti-ACPP / PAP (aa269-282), Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NHMKRATQIPSYKK., from the internal region of the protein sequence according to NP_001127666.1; NP_001090.2.

Anti-ACPP Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Prostatic Acid Phosphatase (ACPP) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human Prostatic Acid Phosphatase (PAP/Prostatic Acid Phosphatase (ACPP)) (NP_001090.2).
Modifications Unmodified

Prostatic Acid Phosphatase Mouse monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human Prostatic Acid Phosphatase(PSAP)

Prostatic Acid Phosphatase (PT1651) Mouse monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human Prostatic Acid Phosphatase(PSAP)