Prostatic Acid Phosphatase (ACPP) Rabbit Polyclonal Antibody

CAT#: TA346274

Rabbit Polyclonal Anti-ACPP Antibody

Product Images

WB Suggested Anti-ACPP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: acid phosphatase, prostate
• Database Link:
  NP_001090
  Entrez Gene 55 Human
  UniProt ID P15309
• Background: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway.
• Synonyms: 5 -NT; 5'-NT; ACP-3; ACP3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome, Phosphatase, Transmembrane
• Protein Pathways: Riboflavin metabolism