Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-ACPP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV |
USD 440.00
2 Weeks
Prostatic Acid Phosphatase (ACPP) mouse monoclonal antibody, clone M01010921, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
Acpp (Pain System Marker) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Mouse |
| Immunogen | Recombinant Mouse PAP protein was expressed using a baculoviral-delivery system. Preparation: After repeated injections, immune eggs were collected from laying hens, from which IgY antibody were prepared (“anti-PAP IgY fraction”). Some of this antibody was further purified using an agarose matrix to which the PAP protein was convalently attached (“Affinity-purified anti-PAP”). The final preparation in the accompanying vial contains 10 mg/ml of the “anti-PAP IgY fraction” supplemented with 20 mg/ml of the “affinity-purified anti-PAP” plus 50% (v/v) Glycerol (to prevent freezing at –20°C). Finally, this antibody preparation was filter-sterilized (0.45 mm) and 200 µl aliquots prepared. |
Rabbit polyclonal antibody to ACPP (acid phosphatase, prostate)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 177 and 362 of Prostatic Acid Phosphatase |
Goat Anti-ACPP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YGIHKQKEKSRLQ, from the internal region of the protein sequence according to NP_001090.2. |
Mouse anti Prostate Specific Acid Phosphatase Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Goat Anti-ACPP / PAP (aa269-282), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NHMKRATQIPSYKK., from the internal region of the protein sequence according to NP_001127666.1; NP_001090.2. |
Anti-ACPP Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
Anti-ACPP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
USD 665.00
3 Weeks
Prostatic Acid Phosphatase Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Prostatic Acid Phosphatase (ACPP) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human Prostatic Acid Phosphatase (PAP/Prostatic Acid Phosphatase (ACPP)) (NP_001090.2). |
| Modifications | Unmodified |
USD 380.00
4 Weeks
Germany
Japan
United Kingdom
China
