Rabbit Polyclonal Anti-TMEM16A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM16A antibody: synthetic peptide directed towards the middle region of human TMEM16A. Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY |
Rabbit Polyclonal TMEM16A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TMEM16A antibody was raised against a 17 amino acid peptide from near the amino terminus of human TMEM16A. |
Rabbit Polyclonal DOG1/TMEM16A Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-ANO1 / TM16A antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TM16A. |
ANO1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 628-731 of human ANO1 (NP_060513.5). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
