Antibodies

View as table Download

Rabbit polyclonal anti-CAF1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAF1B.

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the C terminal of human CHAF1B. Synthetic peptide located within the following region: PPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD

p60 CAF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-559 of human p60 CAF1 (NP_005432.1).
Modifications Unmodified