Antibodies

Jump to Filters
View as table Download
ETV7 Rabbit Polyclonal Antibody
TA349948

USD 345.00

In Stock

Rabbit Polyclonal Anti-ETV7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ETV7
ETV7 Rabbit Polyclonal Antibody
TA373003

USD 380.00

4 Weeks

ETV7 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ETV7
TA373003 is a possible alternative to TA349948.
ETV7 Rabbit Polyclonal Antibody
TA331927

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETV7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
ETV7 Rabbit Polyclonal Antibody
TA339482

USD 375.00

5 Days

Rabbit Polyclonal Anti-ETV7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETV7 antibody: synthetic peptide directed towards the C terminal of human ETV7. Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS
ETV7 Rabbit Polyclonal Antibody
TA376020

USD 220.00

3 Weeks

ETV7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human ETV7 (NP_057219.1).
Modifications Unmodified