ETV7 Rabbit Polyclonal Antibody

CAT#: TA331927

Rabbit Polyclonal Anti-ETV7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ETV7"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name ETS variant 7
Background As a transcriptional repressor; ETV7 binds to the DNA sequence 5'-CCGGAAGT-3'. But Isoform A and isoform C do not seem to have a repressor activity.
Synonyms TEL-2; TEL2; TELB
Note Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rabbit: 86%; Zebrafish: 79%; Rat: 77%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Dorso-ventral axis formation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.