Rabbit polyclonal Fibrillin-1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Fibrillin-1. |
Rabbit polyclonal Fibrillin-1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Fibrillin-1. |
Rabbit Polyclonal Anti-FBN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBN1 antibody: synthetic peptide directed towards the N terminal of human FBN1. Synthetic peptide located within the following region: MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGH |
Anti-FBN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2837-2853 amino acids of Human fibrillin 1 |
Anti-FBN1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2837-2853 amino acids of Human fibrillin 1 |