Antibodies

View as table Download

Rabbit Polyclonal Anti-PEA15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEA15 antibody: synthetic peptide directed towards the middle region of human PEA15. Synthetic peptide located within the following region: DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL

Rabbit polyclonal PEA-15 (Ser104) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PEA-15 around the phosphorylation site of serine 104(I-P-SP-A-K).
Modifications Phospho-specific

Rabbit polyclonal anti-PEA-15 antibody

Applications IHC
Reactivities Human, MouseRat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PEA-15.

Rabbit Polyclonal Anti-PEA15 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PEA15

PEA15 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PEA15

PEA15 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PEA15

PEA15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEA15 (NP_003759.1).
Modifications Unmodified

Phospho-PEA15-S104 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S104 of human PEA15 (NP_003759.1).
Modifications Phospho S104

Phospho-PEA15-S104 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S104 of human PEA15 (NP_003759.1).
Modifications Phospho S104