Antibodies

Jump to Filters
View as table Download
QSOX2 Rabbit Polyclonal Antibody
TA317240

USD 425.00

5 Days

QSOX2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen QSOX2 antibody was raised against synthetic 20 amino acid peptide from internal region of human QSOX2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Bat, Horse (100%); Rat, Bovine (95%); Dog, Hamster (90%); Panda, Opossum (85%); Turkey, Chicken (80%).
QSOX2 Rabbit Polyclonal Antibody
TA334359

USD 375.00

5 Days

Rabbit Polyclonal Anti-QSOX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-QSOX2 antibody is: synthetic peptide directed towards the middle region of Human QSOX2. Synthetic peptide located within the following region: VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY