Antibodies

Jump to Filters
View as table Download
RNF14 Rabbit Polyclonal Antibody
TA347794

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-RNF14 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF14 Antibody: A synthesized peptide derived from human RNF14
RNF14 Rabbit Polyclonal Antibody
TA343453

USD 375.00

5 Days

Rabbit Polyclonal Anti-RNF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the N terminal of human RNF14. Synthetic peptide located within the following region: MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFV
RNF14 Rabbit Polyclonal Antibody
TA343454

USD 310.00

5 Days

Rabbit Polyclonal Anti-RNF14 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the C terminal of human RNF14. Synthetic peptide located within the following region: CMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
RNF14 Rabbit Polyclonal Antibody
TA350362

USD 345.00

In Stock

Rabbit Polyclonal Anti-RNF14 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RNF14
RNF14 Rabbit Polyclonal Antibody
TA361613

USD 360.00

5 Days

RNF14 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14
RNF14 Rabbit Polyclonal Antibody
TA380976

USD 220.00

3 Weeks

RNF14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-474 of human RNF14 (NP_004281.1).