RNF14 Rabbit Polyclonal Antibody

CAT#: TA343453

Rabbit Polyclonal Anti-RNF14 Antibody

Product Images

WB Suggested Anti-RNF14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: COLO205 cell lysateRNF14 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the N terminal of human RNF14. Synthetic peptide located within the following region: MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: ring finger protein 14
• Database Link:
  NP_004281
  Entrez Gene 9604 Human
  UniProt ID Q9UBS8
• Background: RNF14 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative m
• Synonyms: ARA54; HFB30; HRIHFB2038; TRIAD2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors