Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-RNF14 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF14 Antibody: A synthesized peptide derived from human RNF14 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Rnf14 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rnf14 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS |
Rabbit Polyclonal Anti-Rnf14 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rnf14 antibody is: synthetic peptide directed towards the middle region of Rat Rnf14. Synthetic peptide located within the following region: QASSNTELALGGAAAAAAASDVDQEDSVDERAVQDVESLSSLIQEILDFN |
Rabbit Polyclonal Anti-RNF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the N terminal of human RNF14. Synthetic peptide located within the following region: MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFV |
Rabbit Polyclonal Anti-RNF14 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNF14 antibody: synthetic peptide directed towards the C terminal of human RNF14. Synthetic peptide located within the following region: CMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED |
Carrier-free (BSA/glycerol-free) RNF14 mouse monoclonal antibody,clone OTI3A4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RNF14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RNF14 |
RNF14 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-474 of human RNF14 (NP_004281.1). |
RNF14 mouse monoclonal antibody,clone OTI3A4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RNF14 mouse monoclonal antibody,clone OTI3A4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RNF14 mouse monoclonal antibody,clone OTI3A4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RNF14 mouse monoclonal antibody,clone OTI3A4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- RNF14