Antibodies

View as table Download

Rabbit Polyclonal THRAP3 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 930-955 of human Thyroid hormone receptor associated protein 3 was used as the immunogen

Rabbit Polyclonal Anti-THRAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3. Synthetic peptide located within the following region: GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDN

Rabbit polyclonal anti-THRAP3 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen THRAP3

THRAP3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human THRAP3
Modifications Unmodified