Goat Anti-AGTPBP1 / NNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2. |
Goat Anti-AGTPBP1 / NNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2. |
Rabbit Polyclonal Anti-Agtpbp1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Agtpbp1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Agtpbp1. Synthetic peptide located within the following region: GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT |
AGTPBP1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 320-520 of human AGTPBP1 (NP_056054.2). |
Modifications | Unmodified |