Agtpbp1 Rabbit Polyclonal Antibody

CAT#: TA333691

Rabbit Polyclonal Anti-Agtpbp1 Antibody

Product Images

Host: Rabbit; Target Name: Agtpbp1; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Agtpbp1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Agtpbp1. Synthetic peptide located within the following region: GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 128 kDa
• Gene Name: ATP/GTP binding protein 1
• Database Link:
  NP_075817
  Entrez Gene 67269 Mouse
  UniProt ID Q641K1
• Background: Agtpbp1 is a metallocarboxypeptidase that mediates deglutamylation of target proteins. It catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. It also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Agtpbp1 acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5. Deglutamylation plays a key role in cerebellar Purkinje cell differentiation, accumulation of tubulin polyglutamylation causing neurodegeneration.
• Synonyms: CCP1; DKFZp686M20191; KIAA1035; NNA1
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 92%