Germany
Japan
United Kingdom
China
Goat Anti-AGTPBP1 / NNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Agtpbp1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Agtpbp1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Agtpbp1. Synthetic peptide located within the following region: GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT |
Rabbit Polyclonal Anti-AGTPBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AGTPBP1 Antibody: synthetic peptide directed towards the N terminal of human AGTPBP1. Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
AGTPBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 320-520 of human AGTPBP1 (NP_056054.2). |
| Modifications | Unmodified |
AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 1C8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 1C8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 9C8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 9C8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- AGTPBP1