AGTPBP1 Rabbit Polyclonal Antibody

CAT#: TA333833

Rabbit Polyclonal Anti-AGTPBP1 Antibody

Product Images

WB Suggested Anti-AGTPBP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AGTPBP1 Antibody: synthetic peptide directed towards the N terminal of human AGTPBP1. Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 134 kDa
• Gene Name: ATP/GTP binding protein 1
• Database Link:
  NP_056054
  Entrez Gene 23287 Human
  UniProt ID Q9UPW5
• Background: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.
• Synonyms: CCP1; NNA1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Protease