Antibodies

Jump to Filters
View as table Download
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA312229

USD 345.00

4 Weeks

Rabbit polyclonal anti-CAF1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAF1B.
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA338925

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHAF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CHAF1B antibody: synthetic peptide directed towards the N terminal of human CHAF1B. Synthetic peptide located within the following region: KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD
p60 CAF1 (CHAF1B) Rabbit Polyclonal Antibody
TA374702

USD 220.00

3 Weeks

p60 CAF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-559 of human p60 CAF1 (NP_005432.1).
Modifications Unmodified