Antibodies

Jump to Filters
View as table Download
MRTFA Rabbit Polyclonal Antibody
TA315677

USD 345.00

In Stock

Rabbit polyclonal anti-MKL1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MKL1.
Mrtfa Rabbit Polyclonal Antibody
TA329591

USD 310.00

5 Days

Rabbit polyclonal anti-MKL1 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MKL1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK