Mrtfa Rabbit Polyclonal Antibody

CAT#: TA329591

Rabbit polyclonal anti-MKL1 antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Mrtfa"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MKL1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 106 kDa
Gene Name MKL (megakaryoblastic leukemia)/myocardin-like 1
Background MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Synonyms AMKL; BSAC; KIAA1438; MAL; MRTF-A; OTTHUMP00000199247
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Human: 79%; Zebrafish: 75%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.