Mrtfa Rabbit Polyclonal Antibody

CAT#: TA329591

Rabbit polyclonal anti-MKL1 antibody

Product Images

WB Suggested Anti-MKL1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MKL1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: MKL (megakaryoblastic leukemia)/myocardin-like 1
• Database Link:
  NP_694629
  Entrez Gene 223701 Mouse
  UniProt ID Q8K4J6
• Background: MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
• Synonyms: AMKL; BSAC; KIAA1438; MAL; MRTF-A; OTTHUMP00000199247
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Human: 79%; Zebrafish: 75%