Rabbit polyclonal MIP 3 alpha antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant mouse MIP-3a protein. |
Rabbit Polyclonal anti-Ccl20 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI |
Germany
Japan
United Kingdom
China