Ccl20 Rabbit Polyclonal Antibody

CAT#: TA329180

Rabbit Polyclonal anti-Ccl20 antibody

Product Images

WB Suggested Anti-Ccl20 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: C-C motif chemokine ligand 20
• Database Link:
  NP_062106
  Entrez Gene 29538 Rat
  UniProt ID P97884
• Background: Ccl20 is a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Ccl20 may play a role in modulating inflammatory cell recruitment to the CNS and therefore contribute to tissue injury in ischemic stroke and autoimmune diseases.
• Synonyms: CKb4; exodus-1; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
• Note: Immunogen sequence homology: Human: 100%; Rat: 94%; Pig: 88%; Horse: 88%; Mouse: 88%; Rabbit: 88%; Guinea pig: 88%; Dog: 85%